Studium proteinových biomarkerů a posttranslačních modifikací pomocí hmotnostní spektrometrie

Bc. Vojtěch FRANC

Master's thesis

Study of protein biomarkers and posttranslational modifications using mass spectrometry

Abstract:

V teoretické části této diplomové práce se pojednává o posttranslačních modifikacích proteinů, obzvláště pak o N- a O-glykosylacích. Popsána je syntéza N- a O-glykanů, jejich funkce a některé strategie jejich analýzy hmotnostní spektrometrií. V experimentální části byly studovány tři glykoproteiny - alpha-2-HS-glykoprotein (asialofetuin), cytokinin oxidasa/dehydrogenasa (CKO) a polymerní myelomový IgA (pIgA1). Asialofetuin byl použit jako standardní protein, zatímco CKO a pIgA1 simulující IgA produkované pacienty trpící IgA nefropatií získaný z University of Alabama, byly použity jako vzorky glykoproteinů. Asialofetuin, což je protein modifikovaný jak N-, tak O-glykosylacemi, byl štěpen trypsinem v roztoku nebo kombinací trypsinu a prolylendoproteasy z Aspergillus niger (PSE). Získané peptidové směsi byly buď přímo měřeny na hmotnostním spektru MALDI ("matrix-assisted laser desorption/ionization") TOF/TOF ("time-of-flight/time-of-flight") MS/MS ("tandem mass spectrometry") nebo separovány použitím chromatografie na obrácené fázi (RP-LC) a následně analyzovány na MALDI-TOF/TOF MS/MS. Pro RP-LC separaci byla použita 35 mm laboratorně připravená kolona a zařízení využívající jednoduchý mikrogradient. To poskytovalo zjednodušení glykopeptidových směsí, výsledkem čehož bylo zlepšení analýzy glykosylací. Hlavním cílem této práce bylo identifikovat O-glykopeptidy a stanovit lokalizaci odpovídajících O-glykosylací v pantové oblasti IgA1. Pro tento účel byl nejprve vzorek pIgA separován použitím SDS-PAGE ("sodium dodecyl sulfate polyacrylamide gel electrophoresis"). Na výsledném elektroferogramu se objevily dva pásy s molekulovými hmotnostmi 63 kDa a 28 kDa, které odpovídaly těžkému a lehkému řetězci IgA1. Protože peptidová sekvence pantové oblasti obsahuje tři cysteinová rezidua, bylo také nezbytné optimalizovat redukci/alkylaci vzorku pIgA1, což vedlo k odstranění nežádoucích peptidových modifikací a zlepšení signálu analyzovaných O-glykopeptidů. Separovaný těžký řetězec byl vyříznut z gelu a podroben štěpení trypsinu v gelu. Peptidová směs byla separována RP-LC využívající zařízení s mikrogradientem a dále analyzována MALDI-TOF/TOF MS/MS. Jedna frakce obsahovala směs různých O-glykoforem tryptického peptidu pantové oblasti. Interpretace MS/MS spekter těchto O-glykopeptidů poskytla jednoznačnou lokalizaci všech O-glykosylačních míst v sedmi nejčetnějších glykoformách, včetně glykoforem galaktosa-deficientních. Naše výsledky reprezentují první přímé určení míst mnohačetné O-glykosylace s komplexní heterogenitou v pantové oblasti IgA1 použitím MALDI TOF/TOF MS/MS. Posledním studovaným glykoproteinem v této práci byl rekombinantní CKO isoenzym 1 z kukuřice (ZmCKO1) exprimovaný v Yarrowia lipolytica. Některá potenciální N-glykosylační místa byla experimentálně potvrzena použitím hmotnostně spektrometrické analýzy. V tryptickém peptidu ZmCKO1 269-LTAPRPGGGGA SFGPMSYVEGSVFVNQSLATDLANTGFFTDADVAR-313 byla potvrzena N-glykosylace na Asn 294 technikou MALDI-TOF/TOF MS/MS. Při použití kyseliny ferulové jako matrice byla na stejném aminokyselinovém reziduu detekována technikou MALDI-TOF hyperglykosylace v rozpětí od Man20GlcNAc2 do Man45GlcNAc2, a to jak v lineárním, tak v reflektronovém modu.

Abstract:

The theoretical part of this diploma thesis deals with postranslational modifications of proteins, especially N- a O-glycosylation. It describes the synthesis N- and O-glycans, their functions and some strategies of their analysis by mass spectrometry. In the experimental part three glycoproteins were studied - alpha-2-HS-glycoprotein (asialofetuin), cytokinin oxidase/dehydrogenase (CKO) and polymer myeloma IgA1 (pIgA1). Asialofetuin was used as a standard protein, while CKO sample and pIgA1 simulating IgA from IgA nephropathy patients obtained from University of Alabama were used as sample glycoproteins. Asialofetuin as a protein modified with N- and O-glycosylation was digested in solution with trypsin or combination of trypsin and prolyl specific endoprotease from Aspergillus niger (PSE). The obtained peptide mixtures were either measured directly with matrix-assisted laser desorption/ionization (MALDI) time-of-flight/time-of-flight (TOF/TOF) tandem mass spectrometry or separated using revesed-phase liquid chromatography (RP-LC) and subsequently analyzed by MALDI-TOF/TOF MS/MS. The RP-LC separation using 35 mm laboratory made column using simple microgradient forming device provided simplification of the glycopeptide mixture and resulted in an improved analysis of glycosylation modifications. The primary aim of this work was to identify O-glycopeptides and to determine the localization of corresponding O-glycosylations at the hinge region of IgA1. For this purpose, the analyzed sample of pIgA1 was first separated using sodium dodecyl sulfate polyacrylamide gel electrophoresis (SDS-PAGE). The resulting electropherogram showed two protein bands with the apparent molecular masses of 63 kDa and 28 kDa that correspond to heavy and light chain of IgA1. Because the peptide sequence of hinge region contains three cysteine residues, it was also necessary to optimize the reduction/alkylation of pIgA1 sample, which resulted in removing the undesired peptide modifications and improved signal response of analyzed O-glycopeptides. The separated heavy chain was cut out of the gel and treated in-gel with trypsin. The peptide mixture separated by RP LC microgradient device was further analyzed by MALDI-TOF/TOF MS/MS. One sample fraction contained the mixture of various O-glycoforms of the hinge region tryptic peptide. The interpretation of MS/MS spectra of these O-glycopeptides provided unambiguous localization of all O-glycosylation sites in seven most abundant glycoforms, including the glycoforms deficient in Gal. Our results represent the first direct site assignment of multiple O-glycosylation with complex heterogeneity of the IgA1 hinge region using MALDI TOF/TOF MS/MS. The last studied glycoprotein sample in this work was recombinant maize CKO isoenzyme 1 (ZmCKO1) expressed in Yarrowia lipolytica. Some of the potential N-glycosylation sites were experimentally confirmed using the mass spectrometry analysis. Especially, in the ZmCKO1 tryptic peptide 269-LTAPRPGGGGASFGPMSYVEGSVFVNQSLATDLANTGFFTDADVAR-313, the N-glycosylation at the Asn 294 residue was proved MALDI-TOF/TOF MS/MS. Using ferulic acid as matrix, the hyperglycosylation spanning from Man20GlcNAc2 to Man45GlcNAc2 of the same amino acid residue was detected both in linear and reflectron mode in MALDI-TOF MS analysis.

Keywords

glykoproteomika, hmotnostní spektrometrie, N-glykany, O-glykany, prolyl specific endoprotease

Language used: Czech

Date on which the thesis was submitted / produced: 26. 4. 2011

Identifier: 110909

Thesis defence

• Supervisor: RNDr. Pavel Řehulka, Ph.D.

PALACKÝ UNIVERSITY IN OLOMOUC

Faculty of Science

Master programme / field:
Biochemistry / Biochemistry